Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1009228..1009811 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S1EZP4 |
| Locus tag | PIC05_RS04825 | Protein ID | WP_000254738.1 |
| Coordinates | 1009476..1009811 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | PIC05_RS04820 | Protein ID | WP_000581937.1 |
| Coordinates | 1009228..1009476 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS04810 (1005567) | 1005567..1006868 | + | 1302 | WP_000046814.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| PIC05_RS04815 (1006916) | 1006916..1009150 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| PIC05_RS04820 (1009228) | 1009228..1009476 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PIC05_RS04825 (1009476) | 1009476..1009811 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
| PIC05_RS04830 (1009882) | 1009882..1010673 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| PIC05_RS04835 (1010901) | 1010901..1012538 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| PIC05_RS04840 (1012626) | 1012626..1013924 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1014049..1015377 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T267988 WP_000254738.1 NZ_CP116106:1009476-1009811 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|