Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 875762..876416 | Replicon | chromosome |
| Accession | NZ_CP116106 | ||
| Organism | Escherichia coli strain DETEC-P829 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A140N853 |
| Locus tag | PIC05_RS04260 | Protein ID | WP_000244783.1 |
| Coordinates | 876009..876416 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIC05_RS04255 | Protein ID | WP_000354046.1 |
| Coordinates | 875762..876028 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC05_RS04230 (870931) | 870931..871674 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
| PIC05_RS04235 (871731) | 871731..873164 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
| PIC05_RS04240 (873209) | 873209..873520 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIC05_RS04245 (873684) | 873684..874343 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PIC05_RS04250 (874539) | 874539..875519 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| PIC05_RS04255 (875762) | 875762..876028 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIC05_RS04260 (876009) | 876009..876416 | + | 408 | WP_000244783.1 | protein YgfX | Toxin |
| PIC05_RS04265 (876456) | 876456..876977 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIC05_RS04270 (877089) | 877089..877985 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIC05_RS04275 (878010) | 878010..878720 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIC05_RS04280 (878726) | 878726..880459 | + | 1734 | WP_241226228.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15962.85 Da Isoelectric Point: 11.2669
>T267987 WP_000244783.1 NZ_CP116106:876009-876416 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140N853 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |