Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3763583..3764237 | Replicon | chromosome |
| Accession | NZ_CP116103 | ||
| Organism | Escherichia coli strain DETEC-P836 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PIB67_RS18320 | Protein ID | WP_000244781.1 |
| Coordinates | 3763583..3763990 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIB67_RS18325 | Protein ID | WP_000354046.1 |
| Coordinates | 3763971..3764237 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB67_RS18300 (3759540) | 3759540..3761273 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PIB67_RS18305 (3761279) | 3761279..3761989 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIB67_RS18310 (3762014) | 3762014..3762910 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIB67_RS18315 (3763022) | 3763022..3763543 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIB67_RS18320 (3763583) | 3763583..3763990 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PIB67_RS18325 (3763971) | 3763971..3764237 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIB67_RS18330 (3764480) | 3764480..3765460 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| PIB67_RS18335 (3765537) | 3765537..3766196 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PIB67_RS18340 (3766360) | 3766360..3766671 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIB67_RS18345 (3766716) | 3766716..3768149 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T267976 WP_000244781.1 NZ_CP116103:c3763990-3763583 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|