Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 139531..140174 | Replicon | plasmid pDETEC23 |
Accession | NZ_CP116101 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | PIC52_RS23460 | Protein ID | WP_001034044.1 |
Coordinates | 139758..140174 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | PIC52_RS23455 | Protein ID | WP_001261286.1 |
Coordinates | 139531..139761 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS23440 (134668) | 134668..134898 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC52_RS23445 (134895) | 134895..135311 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
PIC52_RS23450 (135356) | 135356..139150 | - | 3795 | WP_001144731.1 | hypothetical protein | - |
PIC52_RS23455 (139531) | 139531..139761 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PIC52_RS23460 (139758) | 139758..140174 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC52_RS23465 (140249) | 140249..141814 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
PIC52_RS23470 (141799) | 141799..142821 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrS1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..178682 | 178682 | |
- | flank | IS/Tn | - | - | 143075..143578 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T267955 WP_001034044.1 NZ_CP116101:139758-140174 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |