Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 134668..135311 Replicon plasmid pDETEC23
Accession NZ_CP116101
Organism Escherichia coli strain DETEC-P881

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PIC52_RS23445 Protein ID WP_001034046.1
Coordinates 134895..135311 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PIC52_RS23440 Protein ID WP_001261278.1
Coordinates 134668..134898 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC52_RS23410 (130178) 130178..130483 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PIC52_RS23415 (130485) 130485..130703 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PIC52_RS23420 (131295) 131295..131783 + 489 WP_011254646.1 hypothetical protein -
PIC52_RS23425 (131817) 131817..132950 - 1134 WP_000545984.1 DUF3800 domain-containing protein -
PIC52_RS23430 (133117) 133117..133890 - 774 WP_000905949.1 hypothetical protein -
PIC52_RS23435 (133903) 133903..134403 - 501 WP_000528932.1 HEPN family nuclease -
PIC52_RS23440 (134668) 134668..134898 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC52_RS23445 (134895) 134895..135311 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC52_RS23450 (135356) 135356..139150 - 3795 WP_001144731.1 hypothetical protein -
PIC52_RS23455 (139531) 139531..139761 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC52_RS23460 (139758) 139758..140174 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / qnrS1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA 1..178682 178682


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T267954 WP_001034046.1 NZ_CP116101:134895-135311 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT267954 WP_001261278.1 NZ_CP116101:134668-134898 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References