Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 130178..130703 | Replicon | plasmid pDETEC23 |
Accession | NZ_CP116101 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | PIC52_RS23410 | Protein ID | WP_001159868.1 |
Coordinates | 130178..130483 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PIC52_RS23415 | Protein ID | WP_000813634.1 |
Coordinates | 130485..130703 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS23395 (126110) | 126110..127276 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
PIC52_RS23400 (127864) | 127864..128619 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
PIC52_RS23405 (129371) | 129371..130177 | - | 807 | WP_000016982.1 | site-specific integrase | - |
PIC52_RS23410 (130178) | 130178..130483 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PIC52_RS23415 (130485) | 130485..130703 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PIC52_RS23420 (131295) | 131295..131783 | + | 489 | WP_011254646.1 | hypothetical protein | - |
PIC52_RS23425 (131817) | 131817..132950 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
PIC52_RS23430 (133117) | 133117..133890 | - | 774 | WP_000905949.1 | hypothetical protein | - |
PIC52_RS23435 (133903) | 133903..134403 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
PIC52_RS23440 (134668) | 134668..134898 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PIC52_RS23445 (134895) | 134895..135311 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | tet(A) / qnrS1 / dfrA14 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / sitABCD | iroB / iroC / iroD / iroE / iroN / vat / iutA / iucD / iucC / iucB / iucA | 1..178682 | 178682 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T267953 WP_001159868.1 NZ_CP116101:c130483-130178 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|