Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3905563..3906217 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4T2L4 |
| Locus tag | PIC52_RS18945 | Protein ID | WP_000244765.1 |
| Coordinates | 3905810..3906217 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIC52_RS18940 | Protein ID | WP_000354046.1 |
| Coordinates | 3905563..3905829 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS18920 (3901651) | 3901651..3903084 | - | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
| PIC52_RS18925 (3903129) | 3903129..3903440 | + | 312 | WP_001525592.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIC52_RS18930 (3903604) | 3903604..3904263 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
| PIC52_RS18935 (3904340) | 3904340..3905320 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| PIC52_RS18940 (3905563) | 3905563..3905829 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIC52_RS18945 (3905810) | 3905810..3906217 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
| PIC52_RS18950 (3906257) | 3906257..3906778 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIC52_RS18955 (3906890) | 3906890..3907786 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIC52_RS18960 (3907811) | 3907811..3908521 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIC52_RS18965 (3908527) | 3908527..3910260 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T267948 WP_000244765.1 NZ_CP116100:3905810-3906217 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A454A7D7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |