Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 3315140..3315735 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | doc | Uniprot ID | A0A826P6U8 |
Locus tag | PIC52_RS15970 | Protein ID | WP_000155160.1 |
Coordinates | 3315358..3315735 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | D6JG32 |
Locus tag | PIC52_RS15965 | Protein ID | WP_000557315.1 |
Coordinates | 3315140..3315361 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS15940 (3310216) | 3310216..3311325 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PIC52_RS15945 (3311373) | 3311373..3312299 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PIC52_RS15950 (3312296) | 3312296..3313573 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
PIC52_RS15955 (3313570) | 3313570..3314337 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
PIC52_RS15960 (3314339) | 3314339..3315052 | + | 714 | WP_000416895.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
PIC52_RS15965 (3315140) | 3315140..3315361 | + | 222 | WP_000557315.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PIC52_RS15970 (3315358) | 3315358..3315735 | + | 378 | WP_000155160.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PIC52_RS15975 (3315944) | 3315944..3317260 | + | 1317 | WP_001606337.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
PIC52_RS15980 (3317358) | 3317358..3318245 | + | 888 | WP_001606336.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
PIC52_RS15985 (3318242) | 3318242..3319087 | + | 846 | WP_000572183.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
PIC52_RS15990 (3319089) | 3319089..3320159 | + | 1071 | WP_000907823.1 | sn-glycerol 3-phosphate ABC transporter ATP binding protein UgpC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3312296..3320899 | 8603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13945.20 Da Isoelectric Point: 6.4830
>T267945 WP_000155160.1 NZ_CP116100:3315358-3315735 [Escherichia coli]
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT
MTIQFISAEEIIYFHDKLLSVTPGVTGMSDPGRAEALLYRVLNKYEYEGVSDLWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGLILAANPEFVELTVDVAAGKVSLEDIVTRLRQHGT
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A826P6U8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D6JG32 |