Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 3308613..3309413 | Replicon | chromosome |
Accession | NZ_CP116100 | ||
Organism | Escherichia coli strain DETEC-P881 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | F4T503 |
Locus tag | PIC52_RS15930 | Protein ID | WP_000342452.1 |
Coordinates | 3308886..3309413 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | F4T504 |
Locus tag | PIC52_RS15925 | Protein ID | WP_001277107.1 |
Coordinates | 3308613..3308879 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC52_RS15905 (3304272) | 3304272..3304940 | + | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
PIC52_RS15910 (3304933) | 3304933..3305991 | + | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
PIC52_RS15915 (3306236) | 3306236..3307090 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
PIC52_RS15920 (3307361) | 3307361..3308464 | + | 1104 | WP_001021994.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
PIC52_RS15925 (3308613) | 3308613..3308879 | + | 267 | WP_001277107.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
PIC52_RS15930 (3308886) | 3308886..3309413 | + | 528 | WP_000342452.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
PIC52_RS15935 (3309410) | 3309410..3309793 | - | 384 | WP_000778810.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
PIC52_RS15940 (3310216) | 3310216..3311325 | + | 1110 | WP_001296485.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
PIC52_RS15945 (3311373) | 3311373..3312299 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
PIC52_RS15950 (3312296) | 3312296..3313573 | + | 1278 | WP_000803819.1 | branched chain amino acid ABC transporter permease LivM | - |
PIC52_RS15955 (3313570) | 3313570..3314337 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19673.57 Da Isoelectric Point: 6.6348
>T267944 WP_000342452.1 NZ_CP116100:3308886-3309413 [Escherichia coli]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTPDD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061K5K9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061YQ57 |