Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 2077154..2077704 Replicon chromosome
Accession NZ_CP116100
Organism Escherichia coli strain DETEC-P881

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag PIC52_RS10195 Protein ID WP_001160966.1
Coordinates 2077154..2077468 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag PIC52_RS10200 Protein ID WP_000125566.1
Coordinates 2077471..2077704 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC52_RS10170 (2072829) 2072829..2074115 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
PIC52_RS10175 (2074115) 2074115..2075104 + 990 WP_001606798.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PIC52_RS10180 (2075101) 2075101..2075922 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PIC52_RS10185 (2075925) 2075925..2076302 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PIC52_RS10190 (2076309) 2076309..2077157 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PIC52_RS10195 (2077154) 2077154..2077468 - 315 WP_001160966.1 CcdB family protein Toxin
PIC52_RS10200 (2077471) 2077471..2077704 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PIC52_RS10205 (2077790) 2077790..2078269 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
PIC52_RS10210 (2078461) 2078461..2080323 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
PIC52_RS10215 (2080316) 2080316..2080846 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PIC52_RS10220 (2080954) 2080954..2082285 - 1332 WP_001183206.1 MFS transporter -
PIC52_RS10225 (2082344) 2082344..2082631 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T267938 WP_001160966.1 NZ_CP116100:c2077468-2077154 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT267938 WP_000125566.1 NZ_CP116100:c2077704-2077471 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References