Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1677959..1678577 | Replicon | chromosome |
| Accession | NZ_CP116100 | ||
| Organism | Escherichia coli strain DETEC-P881 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | PIC52_RS08335 | Protein ID | WP_001291435.1 |
| Coordinates | 1678359..1678577 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | PIC52_RS08330 | Protein ID | WP_000344800.1 |
| Coordinates | 1677959..1678333 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC52_RS08320 (1673049) | 1673049..1674242 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| PIC52_RS08325 (1674265) | 1674265..1677414 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| PIC52_RS08330 (1677959) | 1677959..1678333 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| PIC52_RS08335 (1678359) | 1678359..1678577 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| PIC52_RS08340 (1678751) | 1678751..1679302 | + | 552 | WP_001606934.1 | maltose O-acetyltransferase | - |
| PIC52_RS08345 (1679418) | 1679418..1679888 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| PIC52_RS08350 (1680052) | 1680052..1681602 | + | 1551 | WP_001606933.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| PIC52_RS08355 (1681644) | 1681644..1681997 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| PIC52_RS08365 (1682376) | 1682376..1682687 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| PIC52_RS08370 (1682718) | 1682718..1683290 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267936 WP_001291435.1 NZ_CP116100:1678359-1678577 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267936 WP_000344800.1 NZ_CP116100:1677959-1678333 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |