Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3915524..3916358 Replicon chromosome
Accession NZ_CP116094
Organism Escherichia coli strain DETEC-S560

Toxin (Protein)


Gene name yeeV Uniprot ID B7MK10
Locus tag PIC78_RS18925 Protein ID WP_000854820.1
Coordinates 3915981..3916358 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag PIC78_RS18920 Protein ID WP_001285610.1
Coordinates 3915524..3915892 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC78_RS18885 (3911245) 3911245..3911925 + 681 WP_001278649.1 WYL domain-containing protein -
PIC78_RS18890 (3912076) 3912076..3912753 + 678 WP_001097565.1 hypothetical protein -
PIC78_RS18895 (3912759) 3912759..3912992 + 234 WP_000883181.1 DUF905 family protein -
PIC78_RS18900 (3913082) 3913082..3913900 + 819 WP_001175155.1 DUF932 domain-containing protein -
PIC78_RS18905 (3914166) 3914166..3914645 + 480 WP_000706978.1 antirestriction protein -
PIC78_RS18910 (3914660) 3914660..3915136 + 477 WP_001186193.1 RadC family protein -
PIC78_RS18915 (3915223) 3915223..3915444 + 222 WP_000692347.1 DUF987 domain-containing protein -
PIC78_RS18920 (3915524) 3915524..3915892 + 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIC78_RS18925 (3915981) 3915981..3916358 + 378 WP_000854820.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIC78_RS18930 (3916355) 3916355..3916552 + 198 Protein_3693 DUF5983 family protein -
PIC78_RS18935 (3916580) 3916580..3916777 + 198 WP_085949158.1 DUF957 domain-containing protein -
PIC78_RS18940 (3916862) 3916862..3917422 + 561 Protein_3695 DUF4942 domain-containing protein -
PIC78_RS18945 (3917789) 3917789..3918325 - 537 WP_000942785.1 GspM family type II secretion system protein YghD -
PIC78_RS18950 (3918327) 3918327..3919505 - 1179 WP_000094991.1 type II secretion system protein GspL -
PIC78_RS18955 (3919502) 3919502..3920479 - 978 WP_000633209.1 type II secretion system minor pseudopilin GspK -
PIC78_RS18960 (3920482) 3920482..3921081 - 600 WP_001255034.1 type II secretion system minor pseudopilin GspJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspE / gspD / gspC 3886306..3977094 90788


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14043.12 Da        Isoelectric Point: 7.8839

>T267911 WP_000854820.1 NZ_CP116094:3915981-3916358 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT267911 WP_001285610.1 NZ_CP116094:3915524-3915892 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2KXX6

Antitoxin

Source ID Structure

References