Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2870566..2871397 Replicon chromosome
Accession NZ_CP116094
Organism Escherichia coli strain DETEC-S560

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PIC78_RS14035 Protein ID WP_271287740.1
Coordinates 2871023..2871397 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID F4THW5
Locus tag PIC78_RS14030 Protein ID WP_001313071.1
Coordinates 2870566..2870934 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC78_RS13995 (2865792) 2865792..2866862 + 1071 WP_000102643.1 patatin-like phospholipase family protein -
PIC78_RS14000 (2866998) 2866998..2867681 + 684 WP_042004735.1 hypothetical protein -
PIC78_RS14005 (2867697) 2867697..2868107 + 411 WP_000846713.1 hypothetical protein -
PIC78_RS14010 (2868328) 2868328..2869149 + 822 WP_001234530.1 DUF932 domain-containing protein -
PIC78_RS14015 (2869231) 2869231..2869710 + 480 WP_000860076.1 antirestriction protein -
PIC78_RS14020 (2869726) 2869726..2870202 + 477 WP_001186726.1 RadC family protein -
PIC78_RS14025 (2870265) 2870265..2870486 + 222 WP_000692301.1 DUF987 domain-containing protein -
PIC78_RS14030 (2870566) 2870566..2870934 + 369 WP_001313071.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIC78_RS14035 (2871023) 2871023..2871397 + 375 WP_271287740.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIC78_RS14040 (2871394) 2871394..2871588 + 195 WP_000988600.1 DUF5983 family protein -
PIC78_RS14045 (2871634) 2871634..2871714 + 81 Protein_2741 hypothetical protein -
PIC78_RS14050 (2872003) 2872003..2872149 - 147 Protein_2742 transposase domain-containing protein -
PIC78_RS14055 (2872251) 2872251..2872385 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
PIC78_RS14060 (2872486) 2872486..2872815 - 330 WP_000450409.1 DUF496 family protein -
PIC78_RS14065 (2872987) 2872987..2874045 - 1059 WP_001200905.1 FUSC family protein -
PIC78_RS14070 (2874243) 2874243..2874716 - 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
PIC78_RS14075 (2874773) 2874773..2875993 - 1221 WP_000343760.1 ISL3-like element ISKox3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2874773..2875993 1220


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13962.94 Da        Isoelectric Point: 7.1333

>T267907 WP_271287740.1 NZ_CP116094:2871023-2871397 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYSEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13498.23 Da        Isoelectric Point: 5.8696

>AT267907 WP_001313071.1 NZ_CP116094:2870566-2870934 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1L2Z3

References