Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 58036..58637 | Replicon | plasmid pDETEC74 |
| Accession | NZ_CP116091 | ||
| Organism | Escherichia coli strain DETEC-S565 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | U9Z1Q0 |
| Locus tag | PIC22_RS25185 | Protein ID | WP_001216047.1 |
| Coordinates | 58036..58416 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | PIC22_RS25190 | Protein ID | WP_001190712.1 |
| Coordinates | 58416..58637 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC22_RS25160 (PIC22_25155) | 53476..54960 | - | 1485 | WP_000124150.1 | terminase | - |
| PIC22_RS25165 (PIC22_25160) | 54960..56153 | - | 1194 | WP_000219608.1 | hypothetical protein | - |
| PIC22_RS25170 (PIC22_25165) | 56240..56692 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| PIC22_RS25175 (PIC22_25170) | 56781..57824 | - | 1044 | WP_000644102.1 | DUF968 domain-containing protein | - |
| PIC22_RS25180 (PIC22_25175) | 57852..58031 | - | 180 | WP_000113019.1 | hypothetical protein | - |
| PIC22_RS25185 (PIC22_25180) | 58036..58416 | - | 381 | WP_001216047.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PIC22_RS25190 (PIC22_25185) | 58416..58637 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PIC22_RS25195 (PIC22_25190) | 58710..59099 | - | 390 | WP_000506730.1 | S24 family peptidase | - |
| PIC22_RS25200 (PIC22_25195) | 59274..59858 | + | 585 | WP_042198310.1 | hypothetical protein | - |
| PIC22_RS25205 (PIC22_25200) | 59859..60215 | + | 357 | WP_001062545.1 | hypothetical protein | - |
| PIC22_RS25210 (PIC22_25205) | 61291..61653 | - | 363 | WP_001261543.1 | hypothetical protein | - |
| PIC22_RS25215 (PIC22_25210) | 61650..62549 | - | 900 | WP_233403841.1 | hypothetical protein | - |
| PIC22_RS25220 (PIC22_25215) | 62526..62660 | - | 135 | Protein_59 | hypothetical protein | - |
| PIC22_RS25225 (PIC22_25220) | 62994..63172 | - | 179 | Protein_60 | hypothetical protein | - |
| PIC22_RS25230 (PIC22_25225) | 63174..63362 | - | 189 | WP_000797279.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..89020 | 89020 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13574.27 Da Isoelectric Point: 5.1514
>T267894 WP_001216047.1 NZ_CP116091:c58416-58036 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9Z1Q0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |