Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 58036..58637 Replicon plasmid pDETEC74
Accession NZ_CP116091
Organism Escherichia coli strain DETEC-S565

Toxin (Protein)


Gene name doc Uniprot ID U9Z1Q0
Locus tag PIC22_RS25185 Protein ID WP_001216047.1
Coordinates 58036..58416 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag PIC22_RS25190 Protein ID WP_001190712.1
Coordinates 58416..58637 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC22_RS25160 (PIC22_25155) 53476..54960 - 1485 WP_000124150.1 terminase -
PIC22_RS25165 (PIC22_25160) 54960..56153 - 1194 WP_000219608.1 hypothetical protein -
PIC22_RS25170 (PIC22_25165) 56240..56692 - 453 WP_001312282.1 late promoter-activating protein (Gp10) -
PIC22_RS25175 (PIC22_25170) 56781..57824 - 1044 WP_000644102.1 DUF968 domain-containing protein -
PIC22_RS25180 (PIC22_25175) 57852..58031 - 180 WP_000113019.1 hypothetical protein -
PIC22_RS25185 (PIC22_25180) 58036..58416 - 381 WP_001216047.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PIC22_RS25190 (PIC22_25185) 58416..58637 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PIC22_RS25195 (PIC22_25190) 58710..59099 - 390 WP_000506730.1 S24 family peptidase -
PIC22_RS25200 (PIC22_25195) 59274..59858 + 585 WP_042198310.1 hypothetical protein -
PIC22_RS25205 (PIC22_25200) 59859..60215 + 357 WP_001062545.1 hypothetical protein -
PIC22_RS25210 (PIC22_25205) 61291..61653 - 363 WP_001261543.1 hypothetical protein -
PIC22_RS25215 (PIC22_25210) 61650..62549 - 900 WP_233403841.1 hypothetical protein -
PIC22_RS25220 (PIC22_25215) 62526..62660 - 135 Protein_59 hypothetical protein -
PIC22_RS25225 (PIC22_25220) 62994..63172 - 179 Protein_60 hypothetical protein -
PIC22_RS25230 (PIC22_25225) 63174..63362 - 189 WP_000797279.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..89020 89020


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13574.27 Da        Isoelectric Point: 5.1514

>T267894 WP_001216047.1 NZ_CP116091:c58416-58036 [Escherichia coli]
MRHISPEELVALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT267894 WP_001190712.1 NZ_CP116091:c58637-58416 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z1Q0

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References