Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 7379..8022 Replicon plasmid pDETEC72
Accession NZ_CP116089
Organism Escherichia coli strain DETEC-S565

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag PIC22_RS23470 Protein ID WP_001034046.1
Coordinates 7606..8022 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag PIC22_RS23465 Protein ID WP_001261278.1
Coordinates 7379..7609 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC22_RS23435 (2889) 2889..3194 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
PIC22_RS23440 (3196) 3196..3414 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
PIC22_RS23445 (3982) 3982..4494 + 513 WP_000151784.1 hypothetical protein -
PIC22_RS23450 (4528) 4528..5661 - 1134 WP_000545984.1 DUF3800 domain-containing protein -
PIC22_RS23455 (5828) 5828..6601 - 774 WP_000905949.1 hypothetical protein -
PIC22_RS23460 (6614) 6614..7114 - 501 WP_000528932.1 HEPN family nuclease -
PIC22_RS23465 (7379) 7379..7609 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PIC22_RS23470 (7606) 7606..8022 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
PIC22_RS23475 (8067) 8067..11861 - 3795 WP_001144731.1 hypothetical protein -
PIC22_RS23480 (12242) 12242..12472 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
PIC22_RS23485 (12469) 12469..12885 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD / tet(A) / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..187674 187674


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T267883 WP_001034046.1 NZ_CP116089:7606-8022 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT267883 WP_001261278.1 NZ_CP116089:7379-7609 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References