Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 2889..3414 | Replicon | plasmid pDETEC72 |
| Accession | NZ_CP116089 | ||
| Organism | Escherichia coli strain DETEC-S565 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | PIC22_RS23435 | Protein ID | WP_001159868.1 |
| Coordinates | 2889..3194 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | PIC22_RS23440 | Protein ID | WP_000813634.1 |
| Coordinates | 3196..3414 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC22_RS23425 (575) | 575..1330 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| PIC22_RS23430 (2082) | 2082..2888 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| PIC22_RS23435 (2889) | 2889..3194 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| PIC22_RS23440 (3196) | 3196..3414 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| PIC22_RS23445 (3982) | 3982..4494 | + | 513 | WP_000151784.1 | hypothetical protein | - |
| PIC22_RS23450 (4528) | 4528..5661 | - | 1134 | WP_000545984.1 | DUF3800 domain-containing protein | - |
| PIC22_RS23455 (5828) | 5828..6601 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| PIC22_RS23460 (6614) | 6614..7114 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
| PIC22_RS23465 (7379) | 7379..7609 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| PIC22_RS23470 (7606) | 7606..8022 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / tet(A) / qnrS1 / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..187674 | 187674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T267882 WP_001159868.1 NZ_CP116089:c3194-2889 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|