Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4385361..4385986 | Replicon | chromosome |
Accession | NZ_CP116088 | ||
Organism | Escherichia coli strain DETEC-S565 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PIC22_RS21290 | Protein ID | WP_000911329.1 |
Coordinates | 4385588..4385986 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PIC22_RS21285 | Protein ID | WP_000450524.1 |
Coordinates | 4385361..4385588 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC22_RS21260 (4381163) | 4381163..4381633 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PIC22_RS21265 (4381633) | 4381633..4382205 | - | 573 | WP_000176191.1 | glycine cleavage system transcriptional repressor | - |
PIC22_RS21270 (4382351) | 4382351..4383229 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PIC22_RS21275 (4383246) | 4383246..4384280 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PIC22_RS21280 (4384493) | 4384493..4385206 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PIC22_RS21285 (4385361) | 4385361..4385588 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PIC22_RS21290 (4385588) | 4385588..4385986 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PIC22_RS21295 (4386133) | 4386133..4386996 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PIC22_RS21300 (4387011) | 4387011..4389026 | + | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PIC22_RS21305 (4389100) | 4389100..4389798 | + | 699 | WP_000679823.1 | esterase | - |
PIC22_RS21310 (4389908) | 4389908..4390108 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T267881 WP_000911329.1 NZ_CP116088:4385588-4385986 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |