Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2287927..2288581 | Replicon | chromosome |
| Accession | NZ_CP116088 | ||
| Organism | Escherichia coli strain DETEC-S565 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | PIC22_RS11335 | Protein ID | WP_000244781.1 |
| Coordinates | 2287927..2288334 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | PIC22_RS11340 | Protein ID | WP_000354046.1 |
| Coordinates | 2288315..2288581 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC22_RS11315 (2283884) | 2283884..2285617 | - | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| PIC22_RS11320 (2285623) | 2285623..2286333 | - | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| PIC22_RS11325 (2286358) | 2286358..2287254 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| PIC22_RS11330 (2287366) | 2287366..2287887 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| PIC22_RS11335 (2287927) | 2287927..2288334 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| PIC22_RS11340 (2288315) | 2288315..2288581 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| PIC22_RS11345 (2288824) | 2288824..2289804 | + | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
| PIC22_RS11350 (2290000) | 2290000..2290659 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| PIC22_RS11355 (2290823) | 2290823..2291134 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
| PIC22_RS11360 (2291179) | 2291179..2292612 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| PIC22_RS11365 (2292669) | 2292669..2293412 | - | 744 | WP_000951951.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T267875 WP_000244781.1 NZ_CP116088:c2288334-2287927 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|