Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1850147..1850984 | Replicon | chromosome |
Accession | NZ_CP116088 | ||
Organism | Escherichia coli strain DETEC-S565 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PIC22_RS09140 | Protein ID | WP_000227784.1 |
Coordinates | 1850442..1850984 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PIC22_RS09135 | Protein ID | WP_001297137.1 |
Coordinates | 1850147..1850458 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC22_RS09110 (1845167) | 1845167..1846114 | + | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
PIC22_RS09115 (1846136) | 1846136..1848127 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PIC22_RS09120 (1848117) | 1848117..1848731 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PIC22_RS09125 (1848731) | 1848731..1849060 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PIC22_RS09130 (1849072) | 1849072..1849962 | + | 891 | WP_000971336.1 | heme o synthase | - |
PIC22_RS09135 (1850147) | 1850147..1850458 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PIC22_RS09140 (1850442) | 1850442..1850984 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PIC22_RS09145 (1851040) | 1851040..1851975 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
PIC22_RS09150 (1852383) | 1852383..1853747 | + | 1365 | WP_001000978.1 | MFS transporter | - |
PIC22_RS09155 (1853875) | 1853875..1854366 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PIC22_RS09160 (1854534) | 1854534..1855445 | + | 912 | WP_000705849.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T267873 WP_000227784.1 NZ_CP116088:1850442-1850984 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|