Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 750446..751084 | Replicon | chromosome |
Accession | NZ_CP116088 | ||
Organism | Escherichia coli strain DETEC-S565 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | PIC22_RS03780 | Protein ID | WP_000813794.1 |
Coordinates | 750908..751084 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PIC22_RS03775 | Protein ID | WP_001270285.1 |
Coordinates | 750446..750862 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC22_RS03755 (745598) | 745598..746539 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
PIC22_RS03760 (746540) | 746540..747553 | - | 1014 | WP_000220411.1 | ABC transporter ATP-binding protein | - |
PIC22_RS03765 (747571) | 747571..748716 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
PIC22_RS03770 (748961) | 748961..750367 | - | 1407 | WP_000760594.1 | PLP-dependent aminotransferase family protein | - |
PIC22_RS03775 (750446) | 750446..750862 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PIC22_RS03780 (750908) | 750908..751084 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PIC22_RS03785 (751306) | 751306..751536 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PIC22_RS03790 (751628) | 751628..753589 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PIC22_RS03795 (753662) | 753662..754198 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
PIC22_RS03800 (754290) | 754290..755465 | + | 1176 | WP_001236268.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 755505..756653 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T267871 WP_000813794.1 NZ_CP116088:c751084-750908 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT267871 WP_001270285.1 NZ_CP116088:c750862-750446 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|