Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 11875..12400 | Replicon | plasmid pDETEC80 |
Accession | NZ_CP116087 | ||
Organism | Escherichia coli strain DETEC-S566 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | S1PFV8 |
Locus tag | PIC95_RS25240 | Protein ID | WP_001159871.1 |
Coordinates | 12095..12400 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | PIC95_RS25235 | Protein ID | WP_000813634.1 |
Coordinates | 11875..12093 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC95_RS25215 (7580) | 7580..7684 | - | 105 | Protein_10 | tunicamycin resistance protein | - |
PIC95_RS25220 (7697) | 7697..8557 | - | 861 | WP_000557454.1 | aminoglycoside N-acetyltransferase AAC(3)-IId | - |
PIC95_RS25225 (8700) | 8700..9605 | + | 906 | Protein_12 | IS4-like element ISVsa5 family transposase | - |
PIC95_RS25230 (9654) | 9654..10358 | - | 705 | WP_001067858.1 | IS6-like element IS26 family transposase | - |
PIC95_RS25235 (11875) | 11875..12093 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PIC95_RS25240 (12095) | 12095..12400 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PIC95_RS25245 (12401) | 12401..13210 | + | 810 | WP_000016979.1 | site-specific integrase | - |
PIC95_RS25250 (13348) | 13348..13623 | - | 276 | WP_000239529.1 | hypothetical protein | - |
PIC95_RS25255 (13617) | 13617..14261 | - | 645 | WP_000633911.1 | AAA family ATPase | - |
PIC95_RS25260 (14490) | 14490..15461 | + | 972 | WP_001103694.1 | plasmid segregation protein ParM | - |
PIC95_RS25265 (15466) | 15466..15858 | + | 393 | WP_000340835.1 | plasmid partitioning/stability family protein | - |
PIC95_RS25270 (15863) | 15863..16114 | - | 252 | Protein_21 | DUF4113 domain-containing protein | - |
PIC95_RS25275 (16176) | 16176..16973 | - | 798 | WP_000544830.1 | IS21-like element IS21 family helper ATPase IstB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / aac(3)-IId | - | 1..81555 | 81555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T267864 WP_001159871.1 NZ_CP116087:12095-12400 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CCE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3TCJ | |
PDB | 2H3A | |
PDB | 2ADN | |
PDB | 2ADL | |
PDB | 3HPW | |
PDB | 2H3C | |
PDB | 3G7Z | |
AlphaFold DB | A0A829CQY2 |