Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4262348..4263182 | Replicon | chromosome |
| Accession | NZ_CP116085 | ||
| Organism | Escherichia coli strain DETEC-S566 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | PIC95_RS21180 | Protein ID | WP_000854770.1 |
| Coordinates | 4262348..4262725 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | PIC95_RS21185 | Protein ID | WP_001280950.1 |
| Coordinates | 4262814..4263182 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC95_RS21155 (4258459) | 4258459..4260081 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| PIC95_RS21160 (4260872) | 4260872..4261048 | - | 177 | Protein_4144 | helix-turn-helix domain-containing protein | - |
| PIC95_RS21165 (4261415) | 4261415..4261564 | - | 150 | Protein_4145 | hypothetical protein | - |
| PIC95_RS21170 (4261670) | 4261670..4261846 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| PIC95_RS21175 (4261863) | 4261863..4262351 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| PIC95_RS21180 (4262348) | 4262348..4262725 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| PIC95_RS21185 (4262814) | 4262814..4263182 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIC95_RS21190 (4263345) | 4263345..4263566 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| PIC95_RS21195 (4263629) | 4263629..4264105 | - | 477 | WP_001186779.1 | RadC family protein | - |
| PIC95_RS21200 (4264121) | 4264121..4264585 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| PIC95_RS21205 (4264927) | 4264927..4265745 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| PIC95_RS21210 (4265863) | 4265863..4266058 | - | 196 | Protein_4154 | DUF905 family protein | - |
| PIC95_RS21215 (4266129) | 4266129..4267765 | - | 1637 | Protein_4155 | AIDA repeat-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4250702..4290646 | 39944 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T267861 WP_000854770.1 NZ_CP116085:c4262725-4262348 [Escherichia coli]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT267861 WP_001280950.1 NZ_CP116085:c4263182-4262814 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |