Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4082884..4083434 Replicon chromosome
Accession NZ_CP116085
Organism Escherichia coli strain DETEC-S566

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag PIC95_RS20265 Protein ID WP_001160966.1
Coordinates 4082884..4083198 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag PIC95_RS20270 Protein ID WP_000125566.1
Coordinates 4083201..4083434 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC95_RS20240 (4078559) 4078559..4079845 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
PIC95_RS20245 (4079845) 4079845..4080834 + 990 WP_242812416.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
PIC95_RS20250 (4080831) 4080831..4081652 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
PIC95_RS20255 (4081655) 4081655..4082032 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
PIC95_RS20260 (4082039) 4082039..4082887 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
PIC95_RS20265 (4082884) 4082884..4083198 - 315 WP_001160966.1 CcdB family protein Toxin
PIC95_RS20270 (4083201) 4083201..4083434 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
PIC95_RS20275 (4083520) 4083520..4083999 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
PIC95_RS20280 (4084191) 4084191..4086053 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
PIC95_RS20285 (4086046) 4086046..4086576 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
PIC95_RS20290 (4086684) 4086684..4088015 - 1332 WP_001183207.1 MFS transporter -
PIC95_RS20295 (4088074) 4088074..4088361 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T267859 WP_001160966.1 NZ_CP116085:c4083198-4082884 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT267859 WP_000125566.1 NZ_CP116085:c4083434-4083201 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References