Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3668863..3669481 | Replicon | chromosome |
Accession | NZ_CP116085 | ||
Organism | Escherichia coli strain DETEC-S566 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC95_RS18325 | Protein ID | WP_001291435.1 |
Coordinates | 3669263..3669481 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC95_RS18320 | Protein ID | WP_000344800.1 |
Coordinates | 3668863..3669237 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC95_RS18310 (3663952) | 3663952..3665145 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIC95_RS18315 (3665168) | 3665168..3668317 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
PIC95_RS18320 (3668863) | 3668863..3669237 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC95_RS18325 (3669263) | 3669263..3669481 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC95_RS18330 (3669654) | 3669654..3670205 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
PIC95_RS18335 (3670321) | 3670321..3670791 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PIC95_RS18340 (3670955) | 3670955..3672505 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC95_RS18345 (3672547) | 3672547..3672900 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
PIC95_RS18355 (3673279) | 3673279..3673590 | + | 312 | WP_000409908.1 | MGMT family protein | - |
PIC95_RS18360 (3673621) | 3673621..3674193 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267857 WP_001291435.1 NZ_CP116085:3669263-3669481 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267857 WP_000344800.1 NZ_CP116085:3668863-3669237 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |