Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1945058..1945889 Replicon chromosome
Accession NZ_CP116085
Organism Escherichia coli strain DETEC-S566

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PIC95_RS09355 Protein ID WP_000854814.1
Coordinates 1945058..1945432 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag PIC95_RS09360 Protein ID WP_001546021.1
Coordinates 1945521..1945889 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC95_RS09320 (1941053) 1941053..1941382 + 330 WP_000450409.1 DUF496 family protein -
PIC95_RS09325 (1941483) 1941483..1941806 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
PIC95_RS09330 (1941785) 1941785..1941865 + 81 WP_023441679.1 hypothetical protein -
PIC95_RS09335 (1942076) 1942076..1943617 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
PIC95_RS09340 (1943632) 1943632..1944378 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
PIC95_RS09345 (1944741) 1944741..1944821 - 81 Protein_1830 hypothetical protein -
PIC95_RS09350 (1944867) 1944867..1945061 - 195 WP_000988601.1 DUF5983 family protein -
PIC95_RS09355 (1945058) 1945058..1945432 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIC95_RS09360 (1945521) 1945521..1945889 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PIC95_RS09365 (1945969) 1945969..1946190 - 222 WP_000692323.1 DUF987 domain-containing protein -
PIC95_RS09370 (1946253) 1946253..1946729 - 477 WP_001610726.1 RadC family protein -
PIC95_RS09375 (1946745) 1946745..1947218 - 474 WP_001385393.1 antirestriction protein -
PIC95_RS09380 (1947481) 1947481..1948302 - 822 WP_001234710.1 DUF932 domain-containing protein -
PIC95_RS09385 (1948523) 1948523..1948933 - 411 WP_000846704.1 hypothetical protein -
PIC95_RS09390 (1948949) 1948949..1949626 - 678 WP_001362823.1 hypothetical protein -
PIC95_RS09395 (1949762) 1949762..1950832 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T267850 WP_000854814.1 NZ_CP116085:c1945432-1945058 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT267850 WP_001546021.1 NZ_CP116085:c1945889-1945521 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References