Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 794544..795378 | Replicon | chromosome |
| Accession | NZ_CP116085 | ||
| Organism | Escherichia coli strain DETEC-S566 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PIC95_RS03885 | Protein ID | WP_001546109.1 |
| Coordinates | 794544..794921 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A7I0L0C8 |
| Locus tag | PIC95_RS03890 | Protein ID | WP_001546108.1 |
| Coordinates | 794998..795378 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC95_RS03855 (790939) | 790939..791109 | - | 171 | Protein_757 | IS110 family transposase | - |
| PIC95_RS03860 (791526) | 791526..792459 | - | 934 | Protein_758 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| PIC95_RS03865 (792452) | 792452..792847 | - | 396 | WP_000208383.1 | DUF6088 family protein | - |
| PIC95_RS03870 (792916) | 792916..793761 | - | 846 | WP_001280441.1 | DUF4942 domain-containing protein | - |
| PIC95_RS03875 (793846) | 793846..794043 | - | 198 | WP_000839260.1 | DUF957 domain-containing protein | - |
| PIC95_RS03880 (794060) | 794060..794547 | - | 488 | Protein_762 | DUF5983 family protein | - |
| PIC95_RS03885 (794544) | 794544..794921 | - | 378 | WP_001546109.1 | TA system toxin CbtA family protein | Toxin |
| PIC95_RS03890 (794998) | 794998..795378 | - | 381 | WP_001546108.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PIC95_RS03895 (795428) | 795428..796072 | - | 645 | WP_000086755.1 | hypothetical protein | - |
| PIC95_RS03900 (796091) | 796091..796312 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| PIC95_RS03905 (796381) | 796381..796857 | - | 477 | WP_001424026.1 | RadC family protein | - |
| PIC95_RS03910 (796873) | 796873..797358 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| PIC95_RS03915 (797413) | 797413..798231 | - | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| PIC95_RS03920 (798331) | 798331..798564 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| PIC95_RS03925 (798643) | 798643..799098 | - | 456 | WP_001545736.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | kpsM / kpsT / ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 772491..796072 | 23581 | |
| - | flank | IS/Tn | - | - | 790939..791094 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13986.00 Da Isoelectric Point: 8.5190
>T267847 WP_001546109.1 NZ_CP116085:c794921-794544 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYKMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13997.78 Da Isoelectric Point: 5.0823
>AT267847 WP_001546108.1 NZ_CP116085:c795378-794998 [Escherichia coli]
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
MSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFNNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|