267838

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 18792..19273 Replicon plasmid pDETEC49
Accession NZ_CP116078
Organism Escherichia coli strain DETEC-S586

Toxin (Protein)


Gene name TsxA Uniprot ID -
Locus tag PIC49_RS25630 Protein ID WP_129914605.1
Coordinates 18792..19046 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID -
Locus tag PIC49_RS25635 Protein ID WP_129914604.1
Coordinates 19043..19273 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC49_RS25605 (PIC49_25610) 16063..16392 + 330 WP_001541974.1 type II toxin-antitoxin system RelE/ParE family toxin -
PIC49_RS25610 (PIC49_25615) 16373..16654 + 282 WP_000780222.1 helix-turn-helix transcriptional regulator -
PIC49_RS25615 (PIC49_25620) 16669..16995 + 327 WP_129914608.1 DNA-binding protein -
PIC49_RS25620 (PIC49_25625) 17632..18147 + 516 WP_129914607.1 J domain-containing protein -
PIC49_RS25625 (PIC49_25630) 18253..18795 + 543 WP_129914606.1 hypothetical protein -
PIC49_RS25630 (PIC49_25635) 18792..19046 + 255 WP_129914605.1 hypothetical protein Toxin
PIC49_RS25635 (PIC49_25640) 19043..19273 + 231 WP_129914604.1 XRE family transcriptional regulator Antitoxin
PIC49_RS25640 (PIC49_25645) 19875..20147 + 273 WP_106668253.1 hypothetical protein -
PIC49_RS25645 (PIC49_25650) 20220..20519 + 300 WP_129914603.1 hypothetical protein -
PIC49_RS25650 (PIC49_25655) 20831..21079 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
PIC49_RS25655 (PIC49_25660) 21076..21423 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
PIC49_RS25660 (PIC49_25665) 21787..22290 + 504 WP_000781817.1 DNA distortion polypeptide 1 -
PIC49_RS25665 (PIC49_25670) 22294..23523 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
PIC49_RS25670 (PIC49_25675) 23600..23866 + 267 WP_000134734.1 hypothetical protein -
PIC49_RS25675 (PIC49_25680) 23871..24104 + 234 WP_000120384.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-14 - 1..42640 42640


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9889.42 Da        Isoelectric Point: 9.8108

>T267838 WP_129914605.1 NZ_CP116078:18792-19046 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTEGKTKTTKITLSELVFNDNEVEAIDFTKNGLRPVDKNVLLTMMKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8774.17 Da        Isoelectric Point: 9.1319

>AT267838 WP_129914604.1 NZ_CP116078:19043-19273 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLCKRRKNDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References