Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4258349..4259163 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | PIC49_RS20460 | Protein ID | WP_001054376.1 |
Coordinates | 4258349..4258606 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | PIC49_RS20465 | Protein ID | WP_001309181.1 |
Coordinates | 4258618..4259163 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS20435 (4253637) | 4253637..4254743 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
PIC49_RS20440 (4254808) | 4254808..4255788 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
PIC49_RS20445 (4255898) | 4255898..4256103 | + | 206 | Protein_4001 | HNH endonuclease | - |
PIC49_RS20450 (4256371) | 4256371..4257611 | - | 1241 | Protein_4002 | helicase YjhR | - |
PIC49_RS20455 (4257727) | 4257727..4257858 | + | 132 | WP_001309182.1 | hypothetical protein | - |
PIC49_RS20460 (4258349) | 4258349..4258606 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
PIC49_RS20465 (4258618) | 4258618..4259163 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
PIC49_RS20470 (4259219) | 4259219..4259965 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
PIC49_RS20475 (4260134) | 4260134..4260352 | + | 219 | Protein_4007 | hypothetical protein | - |
PIC49_RS20480 (4260390) | 4260390..4260506 | + | 117 | Protein_4008 | VOC family protein | - |
PIC49_RS20485 (4260751) | 4260751..4261872 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
PIC49_RS20490 (4261869) | 4261869..4262147 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
PIC49_RS20495 (4262159) | 4262159..4263472 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4250844..4267387 | 16543 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T267828 WP_001054376.1 NZ_CP116074:4258349-4258606 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT267828 WP_001309181.1 NZ_CP116074:4258618-4259163 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|