Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3193717..3194422 | Replicon | chromosome |
| Accession | NZ_CP116074 | ||
| Organism | Escherichia coli strain DETEC-S586 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | PIC49_RS15455 | Protein ID | WP_000539521.1 |
| Coordinates | 3193717..3194103 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PIC49_RS15460 | Protein ID | WP_001280945.1 |
| Coordinates | 3194093..3194422 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC49_RS15435 (3189721) | 3189721..3190347 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| PIC49_RS15440 (3190344) | 3190344..3191459 | - | 1116 | WP_000555038.1 | aldose sugar dehydrogenase YliI | - |
| PIC49_RS15445 (3191570) | 3191570..3191953 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| PIC49_RS15450 (3192166) | 3192166..3193491 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| PIC49_RS15455 (3193717) | 3193717..3194103 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PIC49_RS15460 (3194093) | 3194093..3194422 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| PIC49_RS15465 (3194492) | 3194492..3195820 | - | 1329 | WP_000086879.1 | GGDEF domain-containing protein | - |
| PIC49_RS15470 (3195828) | 3195828..3198176 | - | 2349 | WP_001322378.1 | EAL domain-containing protein | - |
| PIC49_RS15475 (3198354) | 3198354..3199265 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T267825 WP_000539521.1 NZ_CP116074:3193717-3194103 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|