Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2946511..2947295 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | PIC49_RS14285 | Protein ID | WP_000613626.1 |
Coordinates | 2946801..2947295 (+) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | PIC49_RS14280 | Protein ID | WP_001110447.1 |
Coordinates | 2946511..2946804 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS14270 (2941661) | 2941661..2942620 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
PIC49_RS14275 (2943193) | 2943193..2946378 | + | 3186 | WP_000827427.1 | ribonuclease E | - |
PIC49_RS14280 (2946511) | 2946511..2946804 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
PIC49_RS14285 (2946801) | 2946801..2947295 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
PIC49_RS14290 (2947390) | 2947390..2948343 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
PIC49_RS14295 (2948355) | 2948355..2949998 | - | 1644 | WP_000096524.1 | flagellar hook-associated protein FlgK | - |
PIC49_RS14300 (2950064) | 2950064..2951005 | - | 942 | WP_001309406.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
PIC49_RS14305 (2951005) | 2951005..2952102 | - | 1098 | WP_000589320.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T267824 WP_000613626.1 NZ_CP116074:2946801-2947295 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|