Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2599865..2600503 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | B7N4J4 |
Locus tag | PIC49_RS12465 | Protein ID | WP_000813797.1 |
Coordinates | 2600327..2600503 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PIC49_RS12460 | Protein ID | WP_076611057.1 |
Coordinates | 2599865..2600281 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS12440 (2595017) | 2595017..2595958 | - | 942 | WP_001251335.1 | ABC transporter permease | - |
PIC49_RS12445 (2595959) | 2595959..2596972 | - | 1014 | WP_000220413.1 | ABC transporter ATP-binding protein | - |
PIC49_RS12450 (2596990) | 2596990..2598135 | - | 1146 | WP_000047447.1 | ABC transporter substrate-binding protein | - |
PIC49_RS12455 (2598380) | 2598380..2599786 | - | 1407 | WP_000760613.1 | PLP-dependent aminotransferase family protein | - |
PIC49_RS12460 (2599865) | 2599865..2600281 | - | 417 | WP_076611057.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PIC49_RS12465 (2600327) | 2600327..2600503 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PIC49_RS12470 (2600725) | 2600725..2600955 | + | 231 | WP_000494244.1 | YncJ family protein | - |
PIC49_RS12475 (2601047) | 2601047..2603008 | - | 1962 | WP_001309488.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PIC49_RS12480 (2603081) | 2603081..2603617 | - | 537 | WP_000429161.1 | DNA-binding transcriptional regulator SutR | - |
PIC49_RS12485 (2603709) | 2603709..2604881 | + | 1173 | WP_001236223.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T267823 WP_000813797.1 NZ_CP116074:c2600503-2600327 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15251.65 Da Isoelectric Point: 4.5908
>AT267823 WP_076611057.1 NZ_CP116074:c2600281-2599865 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|