Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1950959..1951790 Replicon chromosome
Accession NZ_CP116074
Organism Escherichia coli strain DETEC-S586

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag PIC49_RS09250 Protein ID WP_000854814.1
Coordinates 1950959..1951333 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag PIC49_RS09255 Protein ID WP_001285585.1
Coordinates 1951422..1951790 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC49_RS09210 (1946355) 1946355..1947521 + 1167 WP_000830150.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
PIC49_RS09215 (1947640) 1947640..1948113 + 474 WP_001105389.1 DNA gyrase inhibitor SbmC -
PIC49_RS09220 (1948311) 1948311..1949369 + 1059 WP_001200891.1 FUSC family protein -
PIC49_RS09225 (1949541) 1949541..1949870 + 330 WP_000450409.1 DUF496 family protein -
PIC49_RS09230 (1949971) 1949971..1950105 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
PIC49_RS09235 (1950225) 1950225..1950353 + 129 Protein_1808 transposase domain-containing protein -
PIC49_RS09240 (1950642) 1950642..1950722 - 81 Protein_1809 hypothetical protein -
PIC49_RS09245 (1950768) 1950768..1950962 - 195 WP_000988600.1 DUF5983 family protein -
PIC49_RS09250 (1950959) 1950959..1951333 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PIC49_RS09255 (1951422) 1951422..1951790 - 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PIC49_RS09260 (1951864) 1951864..1952085 - 222 WP_000692323.1 DUF987 domain-containing protein -
PIC49_RS09265 (1952148) 1952148..1952624 - 477 WP_001186726.1 RadC family protein -
PIC49_RS09270 (1952640) 1952640..1953119 - 480 WP_000860087.1 antirestriction protein -
PIC49_RS09275 (1953201) 1953201..1954019 - 819 WP_001234629.1 DUF932 domain-containing protein -
PIC49_RS09280 (1954119) 1954119..1954352 - 234 WP_001119729.1 DUF905 family protein -
PIC49_RS09285 (1954431) 1954431..1954886 - 456 WP_147712073.1 IrmA family protein -
PIC49_RS09290 (1954963) 1954963..1956687 - 1725 Protein_1819 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T267816 WP_000854814.1 NZ_CP116074:c1951333-1950959 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT267816 WP_001285585.1 NZ_CP116074:c1951790-1951422 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References