Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 966146..966800 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | B7N7E0 |
Locus tag | PIC49_RS04750 | Protein ID | WP_000244769.1 |
Coordinates | 966393..966800 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PIC49_RS04745 | Protein ID | WP_000354046.1 |
Coordinates | 966146..966412 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS04725 (962234) | 962234..963667 | - | 1434 | WP_022646090.1 | 6-phospho-beta-glucosidase BglA | - |
PIC49_RS04730 (963712) | 963712..964023 | + | 312 | WP_001182953.1 | N(4)-acetylcytidine aminohydrolase | - |
PIC49_RS04735 (964187) | 964187..964846 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
PIC49_RS04740 (964923) | 964923..965903 | - | 981 | WP_000886049.1 | tRNA-modifying protein YgfZ | - |
PIC49_RS04745 (966146) | 966146..966412 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PIC49_RS04750 (966393) | 966393..966800 | + | 408 | WP_000244769.1 | protein YgfX | Toxin |
PIC49_RS04755 (966840) | 966840..967361 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
PIC49_RS04760 (967473) | 967473..968369 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
PIC49_RS04765 (968394) | 968394..969104 | + | 711 | WP_000715210.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PIC49_RS04770 (969110) | 969110..970843 | + | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16062.03 Da Isoelectric Point: 11.5554
>T267815 WP_000244769.1 NZ_CP116074:966393-966800 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGK
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGK
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829J3T1 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |