Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 828000..828835 Replicon chromosome
Accession NZ_CP116074
Organism Escherichia coli strain DETEC-S586

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2I6T1R7
Locus tag PIC49_RS04000 Protein ID WP_016231184.1
Coordinates 828000..828377 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A7Z1I923
Locus tag PIC49_RS04005 Protein ID WP_016231183.1
Coordinates 828467..828835 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC49_RS03970 (823114) 823114..824262 - 1149 WP_000905926.1 capsule polysaccharide export inner-membrane protein KpsE -
PIC49_RS03975 (824334) 824334..825317 - 984 WP_001298261.1 KpsF/GutQ family sugar-phosphate isomerase -
PIC49_RS03980 (826128) 826128..826298 - 171 Protein_782 IS110 family transposase -
PIC49_RS03985 (826640) 826640..827209 - 570 WP_016231187.1 DUF4942 domain-containing protein -
PIC49_RS03990 (827306) 827306..827503 - 198 WP_016231186.1 DUF957 domain-containing protein -
PIC49_RS03995 (827515) 827515..828003 - 489 WP_016231185.1 DUF5983 family protein -
PIC49_RS04000 (828000) 828000..828377 - 378 WP_016231184.1 TA system toxin CbtA family protein Toxin
PIC49_RS04005 (828467) 828467..828835 - 369 WP_016231183.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PIC49_RS04010 (828885) 828885..829529 - 645 Protein_788 antitoxin of toxin-antitoxin stability system -
PIC49_RS04015 (829548) 829548..829769 - 222 WP_016231182.1 DUF987 domain-containing protein -
PIC49_RS04020 (829832) 829832..830308 - 477 WP_001186774.1 RadC family protein -
PIC49_RS04025 (830324) 830324..830809 - 486 WP_000849596.1 antirestriction protein -
PIC49_RS04030 (830864) 830864..831682 - 819 WP_023909039.1 DUF932 domain-containing protein -
PIC49_RS04035 (831782) 831782..832015 - 234 WP_001119719.1 DUF905 family protein -
PIC49_RS04040 (832101) 832101..832505 + 405 WP_016231180.1 transposase -
PIC49_RS04045 (832502) 832502..832849 + 348 WP_000612617.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14106.07 Da        Isoelectric Point: 8.2905

>T267814 WP_016231184.1 NZ_CP116074:c828377-828000 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13613.43 Da        Isoelectric Point: 6.8413

>AT267814 WP_016231183.1 NZ_CP116074:c828835-828467 [Escherichia coli]
MSDTLPGTTLPDNNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADANHLDQAFPLLMKQLELMFTSS
ELNPHRQNTVTLYAKGLTCHADTLGSCGYVYLAVYPTPETKQ

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2I6T1R7

Antitoxin

Source ID Structure
AlphaFold DB A0A7Z1I923

References