Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 148759..149371 | Replicon | chromosome |
Accession | NZ_CP116074 | ||
Organism | Escherichia coli strain DETEC-S586 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | PIC49_RS00635 | Protein ID | WP_000833473.1 |
Coordinates | 148759..148944 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | PIC49_RS00640 | Protein ID | WP_000499744.1 |
Coordinates | 148961..149371 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC49_RS00625 (145591) | 145591..146742 | + | 1152 | WP_000741501.1 | L-threonine dehydrogenase | - |
PIC49_RS00630 (146943) | 146943..148481 | + | 1539 | WP_001309845.1 | aldehyde dehydrogenase AldB | - |
PIC49_RS00635 (148759) | 148759..148944 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PIC49_RS00640 (148961) | 148961..149371 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PIC49_RS00645 (149443) | 149443..151407 | - | 1965 | WP_001026861.1 | glycoside hydrolase family 127 protein | - |
PIC49_RS00650 (151418) | 151418..152818 | - | 1401 | WP_000204802.1 | MFS transporter | - |
PIC49_RS00655 (153044) | 153044..153859 | + | 816 | WP_000891825.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T267810 WP_000833473.1 NZ_CP116074:148759-148944 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT267810 WP_000499744.1 NZ_CP116074:148961-149371 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|