Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3787535..3788153 | Replicon | chromosome |
Accession | NZ_CP116071 | ||
Organism | Escherichia coli strain DETEC-S589 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIC30_RS19000 | Protein ID | WP_001291435.1 |
Coordinates | 3787935..3788153 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIC30_RS18995 | Protein ID | WP_000344800.1 |
Coordinates | 3787535..3787909 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC30_RS18985 (3782625) | 3782625..3783818 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PIC30_RS18990 (3783841) | 3783841..3786990 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIC30_RS18995 (3787535) | 3787535..3787909 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIC30_RS19000 (3787935) | 3787935..3788153 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIC30_RS19005 (3788327) | 3788327..3788878 | + | 552 | WP_000102543.1 | maltose O-acetyltransferase | - |
PIC30_RS19010 (3788994) | 3788994..3789464 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PIC30_RS19015 (3789628) | 3789628..3791178 | + | 1551 | WP_001350616.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIC30_RS19020 (3791220) | 3791220..3791573 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIC30_RS19030 (3791952) | 3791952..3792263 | + | 312 | WP_000409908.1 | MGMT family protein | - |
PIC30_RS19035 (3792294) | 3792294..3792866 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267794 WP_001291435.1 NZ_CP116071:3787935-3788153 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267794 WP_000344800.1 NZ_CP116071:3787535-3787909 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |