Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) paaR-paaA-parE/-
Location 2043564..2044042 Replicon chromosome
Accession NZ_CP116071
Organism Escherichia coli strain DETEC-S589

Toxin (Protein)


Gene name parE_1 Uniprot ID D8A5B3
Locus tag PIC30_RS09680 Protein ID WP_000936799.1
Coordinates 2043564..2043851 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name paaA Uniprot ID D8A5B4
Locus tag PIC30_RS09685 Protein ID WP_000100899.1
Coordinates 2043851..2044042 (-) Length 64 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC30_RS09650 (2040083) 2040083..2040304 - 222 WP_000560231.1 cell division protein FtsZ -
PIC30_RS09655 (2040350) 2040350..2041198 - 849 WP_000935606.1 Rha family phage regulatory protein -
PIC30_RS09660 (2041766) 2041766..2041987 + 222 WP_000202161.1 hypothetical protein -
PIC30_RS09670 (2042835) 2042835..2043128 - 294 WP_097494701.1 hypothetical protein -
PIC30_RS09675 (2043140) 2043140..2043292 - 153 WP_000379609.1 DUF1391 family protein -
PIC30_RS09680 (2043564) 2043564..2043851 - 288 WP_000936799.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PIC30_RS09685 (2043851) 2043851..2044042 - 192 WP_000100899.1 hypothetical protein Antitoxin
PIC30_RS09690 (2044070) 2044070..2044471 - 402 WP_001329851.1 helix-turn-helix domain-containing protein -
PIC30_RS09695 (2044581) 2044581..2044853 + 273 WP_000887447.1 YdaS family helix-turn-helix protein -
PIC30_RS09700 (2044837) 2044837..2045262 + 426 WP_000693918.1 toxin YdaT family protein -
PIC30_RS09705 (2045334) 2045334..2046404 + 1071 WP_001262355.1 hypothetical protein -
PIC30_RS09710 (2046445) 2046445..2046870 + 426 WP_001151152.1 DUF977 family protein -
PIC30_RS09715 (2047045) 2047045..2047710 + 666 WP_000150294.1 epoxyqueuosine reductase QueH -
PIC30_RS09720 (2047948) 2047948..2048103 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD -
PIC30_RS09725 (2048271) 2048271..2048549 + 279 WP_024193993.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ybtP / ybtQ / ybtX / ybtS 2027149..2076964 49815


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10929.85 Da        Isoelectric Point: 10.1360

>T267781 WP_000936799.1 NZ_CP116071:c2043851-2043564 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVATSSIE
IANIVHARRQFPFPI

Download         Length: 288 bp

Antitoxin


Download         Length: 64 a.a.        Molecular weight: 7035.80 Da        Isoelectric Point: 4.0270

>AT267781 WP_000100899.1 NZ_CP116071:c2044042-2043851 [Escherichia coli]
MSTALSPIVSEFETTEQENSYNEWLRAKVASSLADPRPSIPHDEVMAEMENLIAQIAVTNRSE

Download         Length: 192 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D8A5B3

Antitoxin

Source ID Structure
AlphaFold DB A0A161RC07

References