Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | paaR-paaA-parE/- |
| Location | 2043564..2044042 | Replicon | chromosome |
| Accession | NZ_CP116071 | ||
| Organism | Escherichia coli strain DETEC-S589 | ||
Toxin (Protein)
| Gene name | parE_1 | Uniprot ID | D8A5B3 |
| Locus tag | PIC30_RS09680 | Protein ID | WP_000936799.1 |
| Coordinates | 2043564..2043851 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | paaA | Uniprot ID | D8A5B4 |
| Locus tag | PIC30_RS09685 | Protein ID | WP_000100899.1 |
| Coordinates | 2043851..2044042 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC30_RS09650 (2040083) | 2040083..2040304 | - | 222 | WP_000560231.1 | cell division protein FtsZ | - |
| PIC30_RS09655 (2040350) | 2040350..2041198 | - | 849 | WP_000935606.1 | Rha family phage regulatory protein | - |
| PIC30_RS09660 (2041766) | 2041766..2041987 | + | 222 | WP_000202161.1 | hypothetical protein | - |
| PIC30_RS09670 (2042835) | 2042835..2043128 | - | 294 | WP_097494701.1 | hypothetical protein | - |
| PIC30_RS09675 (2043140) | 2043140..2043292 | - | 153 | WP_000379609.1 | DUF1391 family protein | - |
| PIC30_RS09680 (2043564) | 2043564..2043851 | - | 288 | WP_000936799.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PIC30_RS09685 (2043851) | 2043851..2044042 | - | 192 | WP_000100899.1 | hypothetical protein | Antitoxin |
| PIC30_RS09690 (2044070) | 2044070..2044471 | - | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| PIC30_RS09695 (2044581) | 2044581..2044853 | + | 273 | WP_000887447.1 | YdaS family helix-turn-helix protein | - |
| PIC30_RS09700 (2044837) | 2044837..2045262 | + | 426 | WP_000693918.1 | toxin YdaT family protein | - |
| PIC30_RS09705 (2045334) | 2045334..2046404 | + | 1071 | WP_001262355.1 | hypothetical protein | - |
| PIC30_RS09710 (2046445) | 2046445..2046870 | + | 426 | WP_001151152.1 | DUF977 family protein | - |
| PIC30_RS09715 (2047045) | 2047045..2047710 | + | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
| PIC30_RS09720 (2047948) | 2047948..2048103 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| PIC30_RS09725 (2048271) | 2048271..2048549 | + | 279 | WP_024193993.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ybtP / ybtQ / ybtX / ybtS | 2027149..2076964 | 49815 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10929.85 Da Isoelectric Point: 10.1360
>T267781 WP_000936799.1 NZ_CP116071:c2043851-2043564 [Escherichia coli]
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVATSSIE
IANIVHARRQFPFPI
MLPILWLPSARDDLRQIVAYIAKENIPAARRLKIRIETSVLALSEHPYLYPPSDRVSGLREIVVHPNYIVLYRVATSSIE
IANIVHARRQFPFPI
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D8A5B3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A161RC07 |