Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 19607..20214 Replicon plasmid pDETEC45
Accession NZ_CP116070
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name doc Uniprot ID B7LIH8
Locus tag PID00_RS27825 Protein ID WP_000673985.1
Coordinates 19607..19993 (-) Length 129 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID B7LIH9
Locus tag PID00_RS27830 Protein ID WP_000493532.1
Coordinates 19990..20214 (-) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS27805 (PID00_27800) 14945..16101 + 1157 WP_096122008.1 IS3-like element IS600 family transposase -
PID00_RS27810 (PID00_27805) 16152..17816 - 1665 Protein_22 Tn3 family transposase -
PID00_RS27815 (PID00_27810) 17977..18567 + 591 WP_012605115.1 recombinase family protein -
PID00_RS27820 (PID00_27815) 18734..18904 + 171 WP_012605114.1 hypothetical protein -
PID00_RS27825 (PID00_27820) 19607..19993 - 387 WP_000673985.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PID00_RS27830 (PID00_27825) 19990..20214 - 225 WP_000493532.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PID00_RS27835 (PID00_27830) 20695..20961 + 267 WP_012605122.1 hypothetical protein -
PID00_RS27840 (PID00_27835) 21055..21807 - 753 WP_012605123.1 Gfo/Idh/MocA family oxidoreductase -
PID00_RS27845 (PID00_27840) 21816..22049 - 234 Protein_29 hypothetical protein -
PID00_RS27850 (PID00_27845) 22060..22947 - 888 WP_016232711.1 DMT family transporter -
PID00_RS27855 (PID00_27850) 23235..23471 - 237 WP_000887751.1 hypothetical protein -
PID00_RS27860 23793..23889 + 97 Protein_32 DinQ-like type I toxin DqlB -
PID00_RS27865 (PID00_27855) 23956..24135 + 180 WP_000347021.1 hypothetical protein -
PID00_RS27870 (PID00_27860) 24251..24625 - 375 Protein_34 recombinase family protein -
PID00_RS27875 (PID00_27865) 24986..25078 - 93 Protein_35 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..81965 81965
- inside IScluster/Tn - - 8518..18567 10049


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(11-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 129 a.a.        Molecular weight: 14370.62 Da        Isoelectric Point: 7.0732

>T267776 WP_000673985.1 NZ_CP116070:c19993-19607 [Escherichia coli]
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN

Download         Length: 387 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8361.39 Da        Isoelectric Point: 5.6713

>AT267776 WP_000493532.1 NZ_CP116070:c20214-19990 [Escherichia coli]
MFTCNYSHARDNLASLLELAVDENQPVEIQRRKGGAAVLVDKDAFERYRKAALDAEFAEIMQSHGTAYTELSKR

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A086V9Y9

Antitoxin

Source ID Structure
AlphaFold DB A0A086V9Y8

References