Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 19607..20214 | Replicon | plasmid pDETEC45 |
| Accession | NZ_CP116070 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | B7LIH8 |
| Locus tag | PID00_RS27825 | Protein ID | WP_000673985.1 |
| Coordinates | 19607..19993 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B7LIH9 |
| Locus tag | PID00_RS27830 | Protein ID | WP_000493532.1 |
| Coordinates | 19990..20214 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS27805 (PID00_27800) | 14945..16101 | + | 1157 | WP_096122008.1 | IS3-like element IS600 family transposase | - |
| PID00_RS27810 (PID00_27805) | 16152..17816 | - | 1665 | Protein_22 | Tn3 family transposase | - |
| PID00_RS27815 (PID00_27810) | 17977..18567 | + | 591 | WP_012605115.1 | recombinase family protein | - |
| PID00_RS27820 (PID00_27815) | 18734..18904 | + | 171 | WP_012605114.1 | hypothetical protein | - |
| PID00_RS27825 (PID00_27820) | 19607..19993 | - | 387 | WP_000673985.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| PID00_RS27830 (PID00_27825) | 19990..20214 | - | 225 | WP_000493532.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PID00_RS27835 (PID00_27830) | 20695..20961 | + | 267 | WP_012605122.1 | hypothetical protein | - |
| PID00_RS27840 (PID00_27835) | 21055..21807 | - | 753 | WP_012605123.1 | Gfo/Idh/MocA family oxidoreductase | - |
| PID00_RS27845 (PID00_27840) | 21816..22049 | - | 234 | Protein_29 | hypothetical protein | - |
| PID00_RS27850 (PID00_27845) | 22060..22947 | - | 888 | WP_016232711.1 | DMT family transporter | - |
| PID00_RS27855 (PID00_27850) | 23235..23471 | - | 237 | WP_000887751.1 | hypothetical protein | - |
| PID00_RS27860 | 23793..23889 | + | 97 | Protein_32 | DinQ-like type I toxin DqlB | - |
| PID00_RS27865 (PID00_27855) | 23956..24135 | + | 180 | WP_000347021.1 | hypothetical protein | - |
| PID00_RS27870 (PID00_27860) | 24251..24625 | - | 375 | Protein_34 | recombinase family protein | - |
| PID00_RS27875 (PID00_27865) | 24986..25078 | - | 93 | Protein_35 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | - | 1..81965 | 81965 | |
| - | inside | IScluster/Tn | - | - | 8518..18567 | 10049 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14370.62 Da Isoelectric Point: 7.0732
>T267776 WP_000673985.1 NZ_CP116070:c19993-19607 [Escherichia coli]
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN
MKFVSSQEVIEFHDRLISRDGGVAGMPEPGRADAIIHRVLNMYHYEGVTDIMDLAAVYLVAIARGHIFNDANKRTALFVA
QVFLKRNGVHIISSRISFDEMQIIALNAATGEYNWKMVSDHLKAIILN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086V9Y9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A086V9Y8 |