Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 5253058..5253763 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | PID00_RS25990 | Protein ID | WP_000539521.1 |
| Coordinates | 5253377..5253763 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PID00_RS25985 | Protein ID | WP_001280945.1 |
| Coordinates | 5253058..5253387 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS25970 (5248215) | 5248215..5249126 | + | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
| PID00_RS25975 (5249304) | 5249304..5251652 | + | 2349 | WP_042102082.1 | EAL domain-containing protein | - |
| PID00_RS25980 (5251660) | 5251660..5252988 | + | 1329 | WP_000086919.1 | GGDEF domain-containing protein | - |
| PID00_RS25985 (5253058) | 5253058..5253387 | - | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| PID00_RS25990 (5253377) | 5253377..5253763 | - | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PID00_RS25995 (5253989) | 5253989..5255314 | - | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| PID00_RS26000 (5255527) | 5255527..5255910 | + | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| PID00_RS26005 (5256021) | 5256021..5257136 | + | 1116 | WP_271290524.1 | aldose sugar dehydrogenase YliI | - |
| PID00_RS26010 (5257133) | 5257133..5257759 | - | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T267770 WP_000539521.1 NZ_CP116067:c5253763-5253377 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|