Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4165041..4165873 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | PID00_RS20615 | Protein ID | WP_271290491.1 |
Coordinates | 4165499..4165873 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | PID00_RS20610 | Protein ID | WP_001598216.1 |
Coordinates | 4165041..4165409 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS20590 (4162784) | 4162784..4163602 | + | 819 | WP_261577205.1 | DUF932 domain-containing protein | - |
PID00_RS20595 (4163694) | 4163694..4164179 | + | 486 | WP_000206667.1 | antirestriction protein | - |
PID00_RS20600 (4164195) | 4164195..4164671 | + | 477 | WP_032198294.1 | RadC family protein | - |
PID00_RS20605 (4164740) | 4164740..4164961 | + | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
PID00_RS20610 (4165041) | 4165041..4165409 | + | 369 | WP_001598216.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PID00_RS20615 (4165499) | 4165499..4165873 | + | 375 | WP_271290491.1 | TA system toxin CbtA family protein | Toxin |
PID00_RS20620 (4165870) | 4165870..4166361 | + | 492 | WP_001598218.1 | DUF5983 family protein | - |
PID00_RS20625 (4166373) | 4166373..4166570 | + | 198 | WP_024192776.1 | DUF957 domain-containing protein | - |
PID00_RS20630 (4166655) | 4166655..4166804 | + | 150 | Protein_4029 | hypothetical protein | - |
PID00_RS20635 (4167563) | 4167563..4167706 | - | 144 | Protein_4030 | HNH endonuclease | - |
PID00_RS20640 (4167843) | 4167843..4168493 | + | 651 | Protein_4031 | HNH endonuclease | - |
PID00_RS20645 (4168501) | 4168501..4169481 | - | 981 | WP_096122164.1 | sialate O-acetylesterase | - |
PID00_RS20650 (4169546) | 4169546..4170652 | - | 1107 | WP_053290673.1 | N-acetylneuraminate epimerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB / fimE | 4132661..4174517 | 41856 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14019.03 Da Isoelectric Point: 7.8045
>T267767 WP_271290491.1 NZ_CP116067:4165499-4165873 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
MKTLPDTHVREASRCPSPVTIWQTLLGRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13605.40 Da Isoelectric Point: 7.3992
>AT267767 WP_001598216.1 NZ_CP116067:4165041-4165409 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSRGYVYMAVYPTPETKK
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSRGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|