Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4057499..4058094 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | PID00_RS20125 | Protein ID | WP_000239581.1 |
| Coordinates | 4057744..4058094 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | PID00_RS20120 | Protein ID | WP_001223213.1 |
| Coordinates | 4057499..4057750 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS20070 (4052834) | 4052834..4053415 | - | 582 | WP_016236094.1 | 3'-5' exonuclease | - |
| PID00_RS20075 (4053415) | 4053415..4053645 | - | 231 | WP_016236093.1 | hypothetical protein | - |
| PID00_RS20080 (4053859) | 4053859..4053984 | - | 126 | WP_000021704.1 | hypothetical protein | - |
| PID00_RS20085 (4053981) | 4053981..4054223 | - | 243 | WP_000568659.1 | DUF4754 family protein | - |
| PID00_RS20090 (4054242) | 4054242..4054577 | - | 336 | WP_016237678.1 | DUF4761 family protein | - |
| PID00_RS20095 (4054603) | 4054603..4054797 | - | 195 | WP_016237836.1 | hypothetical protein | - |
| PID00_RS20100 (4054796) | 4054796..4055233 | + | 438 | WP_016237679.1 | hypothetical protein | - |
| PID00_RS20105 (4055315) | 4055315..4055740 | - | 426 | WP_001561239.1 | Cox family DNA-binding protein | - |
| PID00_RS20110 (4055848) | 4055848..4056147 | + | 300 | WP_016237680.1 | helix-turn-helix transcriptional regulator | - |
| PID00_RS20115 (4056214) | 4056214..4057209 | + | 996 | WP_001561241.1 | tyrosine-type recombinase/integrase | - |
| PID00_RS20120 (4057499) | 4057499..4057750 | + | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| PID00_RS20125 (4057744) | 4057744..4058094 | + | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| PID00_RS20130 (4058173) | 4058173..4058703 | - | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| PID00_RS20135 (4059013) | 4059013..4059969 | + | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| PID00_RS20140 (4060109) | 4060109..4061611 | + | 1503 | WP_096122148.1 | sugar ABC transporter ATP-binding protein | - |
| PID00_RS20145 (4061625) | 4061625..4062647 | + | 1023 | WP_001298067.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4021211..4071740 | 50529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T267766 WP_000239581.1 NZ_CP116067:4057744-4058094 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|