Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-ChpS
Location 4057499..4058094 Replicon chromosome
Accession NZ_CP116067
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name chpB Uniprot ID V0SXT4
Locus tag PID00_RS20125 Protein ID WP_000239581.1
Coordinates 4057744..4058094 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID L4JJX7
Locus tag PID00_RS20120 Protein ID WP_001223213.1
Coordinates 4057499..4057750 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS20070 (4052834) 4052834..4053415 - 582 WP_016236094.1 3'-5' exonuclease -
PID00_RS20075 (4053415) 4053415..4053645 - 231 WP_016236093.1 hypothetical protein -
PID00_RS20080 (4053859) 4053859..4053984 - 126 WP_000021704.1 hypothetical protein -
PID00_RS20085 (4053981) 4053981..4054223 - 243 WP_000568659.1 DUF4754 family protein -
PID00_RS20090 (4054242) 4054242..4054577 - 336 WP_016237678.1 DUF4761 family protein -
PID00_RS20095 (4054603) 4054603..4054797 - 195 WP_016237836.1 hypothetical protein -
PID00_RS20100 (4054796) 4054796..4055233 + 438 WP_016237679.1 hypothetical protein -
PID00_RS20105 (4055315) 4055315..4055740 - 426 WP_001561239.1 Cox family DNA-binding protein -
PID00_RS20110 (4055848) 4055848..4056147 + 300 WP_016237680.1 helix-turn-helix transcriptional regulator -
PID00_RS20115 (4056214) 4056214..4057209 + 996 WP_001561241.1 tyrosine-type recombinase/integrase -
PID00_RS20120 (4057499) 4057499..4057750 + 252 WP_001223213.1 type II toxin-antitoxin system antitoxin ChpS Antitoxin
PID00_RS20125 (4057744) 4057744..4058094 + 351 WP_000239581.1 endoribonuclease toxin ChpB Toxin
PID00_RS20130 (4058173) 4058173..4058703 - 531 WP_000055075.1 inorganic diphosphatase -
PID00_RS20135 (4059013) 4059013..4059969 + 957 WP_000265933.1 galactofuranose ABC transporter substrate-binding protein YtfQ -
PID00_RS20140 (4060109) 4060109..4061611 + 1503 WP_096122148.1 sugar ABC transporter ATP-binding protein -
PID00_RS20145 (4061625) 4061625..4062647 + 1023 WP_001298067.1 ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 4021211..4071740 50529


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(8-114)

Antitoxin

SpoVT-AbrB domain

(6-49)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12453.41 Da        Isoelectric Point: 6.2206

>T267766 WP_000239581.1 NZ_CP116067:4057744-4058094 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9331.64 Da        Isoelectric Point: 4.6509

>AT267766 WP_001223213.1 NZ_CP116067:4057499-4057750 [Escherichia coli]
MRITIKRWGNSSGMVIPNVVMKELNLRPGQSVEAQVSNNQLILTPISRRYSLDELLAQCDMNATELSEQDVWGKSTPAGD
EIW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SXT4

Antitoxin

Source ID Structure
AlphaFold DB L4JJX7

References