Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2567084..2567916 Replicon chromosome
Accession NZ_CP116067
Organism Escherichia coli strain DETEC-S792

Toxin (Protein)


Gene name yeeV Uniprot ID S1PD64
Locus tag PID00_RS12985 Protein ID WP_000854753.1
Coordinates 2567542..2567916 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID E3PJ72
Locus tag PID00_RS12980 Protein ID WP_001278232.1
Coordinates 2567084..2567452 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PID00_RS12950 (2562974) 2562974..2564545 - 1572 WP_001403908.1 IS66-like element ISCro1 family transposase -
PID00_RS12955 (2564565) 2564565..2564912 - 348 WP_000624622.1 IS66 family insertion sequence element accessory protein TnpB -
PID00_RS12960 (2564912) 2564912..2565589 - 678 WP_001339397.1 IS66-like element accessory protein TnpA -
PID00_RS12965 (2565660) 2565660..2566145 + 486 WP_000849565.1 antirestriction protein -
PID00_RS12970 (2566161) 2566161..2566637 + 477 WP_001186726.1 RadC family protein -
PID00_RS12975 (2566700) 2566700..2566921 + 222 WP_000692329.1 DUF987 domain-containing protein -
PID00_RS12980 (2567084) 2567084..2567452 + 369 WP_001278232.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
PID00_RS12985 (2567542) 2567542..2567916 + 375 WP_000854753.1 TA system toxin CbtA family protein Toxin
PID00_RS12990 (2567913) 2567913..2568401 + 489 WP_000777547.1 DUF5983 family protein -
PID00_RS12995 (2568413) 2568413..2568610 + 198 WP_000839281.1 DUF957 domain-containing protein -
PID00_RS13000 (2568707) 2568707..2569276 + 570 WP_001290247.1 DUF4942 domain-containing protein -
PID00_RS13005 (2569556) 2569556..2570092 - 537 WP_116835114.1 GspM family type II secretion system protein YghD -
PID00_RS13010 (2570094) 2570094..2571272 - 1179 WP_116835115.1 type II secretion system protein GspL -
PID00_RS13015 (2571269) 2571269..2572246 - 978 WP_000633196.1 type II secretion system minor pseudopilin GspK -
PID00_RS13020 (2572243) 2572243..2572848 - 606 WP_001318033.1 type II secretion system minor pseudopilin GspJ -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - sigA / iutA / iucD / iucC / iucB / iucA / gspM / gspL / gspK / gspJ / gspI / gspH / gspG / gspF / gspE / gspD / gspC 2492357..2627644 135287


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14005.00 Da        Isoelectric Point: 8.2905

>T267759 WP_000854753.1 NZ_CP116067:2567542-2567916 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13491.37 Da        Isoelectric Point: 6.6290

>AT267759 WP_001278232.1 NZ_CP116067:2567084-2567452 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LVU0

Antitoxin

Source ID Structure
AlphaFold DB E3PJ72

References