Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2418016..2418670 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | PID00_RS12230 | Protein ID | WP_000244781.1 |
Coordinates | 2418016..2418423 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | PID00_RS12235 | Protein ID | WP_000354046.1 |
Coordinates | 2418404..2418670 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS12210 (2413974) | 2413974..2415707 | - | 1734 | WP_096121758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
PID00_RS12215 (2415713) | 2415713..2416423 | - | 711 | WP_096121757.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PID00_RS12220 (2416447) | 2416447..2417343 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
PID00_RS12225 (2417455) | 2417455..2417976 | + | 522 | WP_075335445.1 | flavodoxin FldB | - |
PID00_RS12230 (2418016) | 2418016..2418423 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
PID00_RS12235 (2418404) | 2418404..2418670 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
PID00_RS12240 (2418923) | 2418923..2419903 | + | 981 | WP_001562036.1 | tRNA-modifying protein YgfZ | - |
PID00_RS12245 (2419980) | 2419980..2420639 | - | 660 | WP_000250269.1 | hemolysin III family protein | - |
PID00_RS12250 (2420803) | 2420803..2421114 | - | 312 | WP_001182952.1 | N(4)-acetylcytidine aminohydrolase | - |
PID00_RS12255 (2421159) | 2421159..2422592 | + | 1434 | WP_001562037.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T267758 WP_000244781.1 NZ_CP116067:c2418423-2418016 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|