Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2257098..2257681 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | PID00_RS11575 | Protein ID | WP_000254750.1 |
Coordinates | 2257098..2257433 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | PID00_RS11580 | Protein ID | WP_000581937.1 |
Coordinates | 2257433..2257681 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS11555 (2252104) | 2252104..2252925 | + | 822 | WP_271290605.1 | YgcG family protein | - |
PID00_RS11560 (2252985) | 2252985..2254283 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
PID00_RS11565 (2254370) | 2254370..2256007 | - | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
PID00_RS11570 (2256235) | 2256235..2257026 | - | 792 | WP_096122425.1 | nucleoside triphosphate pyrophosphohydrolase | - |
PID00_RS11575 (2257098) | 2257098..2257433 | - | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
PID00_RS11580 (2257433) | 2257433..2257681 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
PID00_RS11585 (2257759) | 2257759..2259993 | - | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
PID00_RS11590 (2260041) | 2260041..2261342 | - | 1302 | WP_001561958.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T267757 WP_000254750.1 NZ_CP116067:c2257433-2257098 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|