Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1952596..1953221 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PID00_RS10130 | Protein ID | WP_000911329.1 |
Coordinates | 1952596..1952994 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PID00_RS10135 | Protein ID | WP_000450524.1 |
Coordinates | 1952994..1953221 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS10110 (1948503) | 1948503..1948703 | + | 201 | WP_000383836.1 | YpfN family protein | - |
PID00_RS10115 (1948784) | 1948784..1949482 | - | 699 | WP_000679819.1 | esterase | - |
PID00_RS10120 (1949556) | 1949556..1951571 | - | 2016 | WP_096122032.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PID00_RS10125 (1951586) | 1951586..1952449 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PID00_RS10130 (1952596) | 1952596..1952994 | - | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PID00_RS10135 (1952994) | 1952994..1953221 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PID00_RS10140 (1953377) | 1953377..1954090 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PID00_RS10145 (1954303) | 1954303..1955337 | - | 1035 | WP_001296286.1 | outer membrane protein assembly factor BamC | - |
PID00_RS10150 (1955354) | 1955354..1956232 | - | 879 | WP_001418108.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PID00_RS10155 (1956378) | 1956378..1956950 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PID00_RS10160 (1956950) | 1956950..1957420 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T267756 WP_000911329.1 NZ_CP116067:c1952994-1952596 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |