Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 641513..642149 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A5F1EUB3 |
Locus tag | PID00_RS03280 | Protein ID | WP_000813796.1 |
Coordinates | 641513..641689 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PID00_RS03285 | Protein ID | WP_076838470.1 |
Coordinates | 641733..642149 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS03260 (637135) | 637135..638307 | - | 1173 | WP_249542485.1 | BenE family transporter YdcO | - |
PID00_RS03265 (638399) | 638399..638935 | + | 537 | WP_096122367.1 | DNA-binding transcriptional regulator SutR | - |
PID00_RS03270 (639008) | 639008..640969 | + | 1962 | WP_001317809.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
PID00_RS03275 (641061) | 641061..641291 | - | 231 | WP_024196315.1 | DUF2554 family protein | - |
PID00_RS03280 (641513) | 641513..641689 | + | 177 | WP_000813796.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
PID00_RS03285 (641733) | 641733..642149 | + | 417 | WP_076838470.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
PID00_RS03290 (642228) | 642228..643634 | + | 1407 | WP_000760605.1 | PLP-dependent aminotransferase family protein | - |
PID00_RS03295 (643879) | 643879..645024 | + | 1146 | WP_001563335.1 | ABC transporter substrate-binding protein | - |
PID00_RS03300 (645042) | 645042..646055 | + | 1014 | WP_096122366.1 | ABC transporter ATP-binding protein | - |
PID00_RS03305 (646056) | 646056..646997 | + | 942 | WP_053290975.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6751.78 Da Isoelectric Point: 11.5666
>T267748 WP_000813796.1 NZ_CP116067:641513-641689 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLN
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15219.59 Da Isoelectric Point: 4.5908
>AT267748 WP_076838470.1 NZ_CP116067:641733-642149 [Escherichia coli]
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYVVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLTNNDHFIEVPLSIASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|