Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 259776..260560 | Replicon | chromosome |
Accession | NZ_CP116067 | ||
Organism | Escherichia coli strain DETEC-S792 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | PID00_RS01240 | Protein ID | WP_000613624.1 |
Coordinates | 259776..260270 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B1LI61 |
Locus tag | PID00_RS01245 | Protein ID | WP_001110446.1 |
Coordinates | 260267..260560 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PID00_RS01220 (254969) | 254969..256066 | + | 1098 | WP_000589326.1 | flagellar basal body P-ring protein FlgI | - |
PID00_RS01225 (256066) | 256066..257007 | + | 942 | WP_096121915.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
PID00_RS01230 (257073) | 257073..258716 | + | 1644 | WP_042105957.1 | flagellar hook-associated protein FlgK | - |
PID00_RS01235 (258728) | 258728..259681 | + | 954 | WP_001212762.1 | flagellar hook-associated protein FlgL | - |
PID00_RS01240 (259776) | 259776..260270 | - | 495 | WP_000613624.1 | GNAT family N-acetyltransferase | Toxin |
PID00_RS01245 (260267) | 260267..260560 | - | 294 | WP_001110446.1 | DUF1778 domain-containing protein | Antitoxin |
PID00_RS01250 (260694) | 260694..263879 | - | 3186 | WP_001563106.1 | ribonuclease E | - |
PID00_RS01255 (264452) | 264452..265411 | + | 960 | WP_001563107.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18142.04 Da Isoelectric Point: 7.7444
>T267747 WP_000613624.1 NZ_CP116067:c260270-259776 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIDRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|