Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 212337..213132 | Replicon | chromosome |
| Accession | NZ_CP116067 | ||
| Organism | Escherichia coli strain DETEC-S792 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | Q93EZ7 |
| Locus tag | PID00_RS00955 | Protein ID | WP_000854917.1 |
| Coordinates | 212758..213132 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D2ACA1 |
| Locus tag | PID00_RS00950 | Protein ID | WP_001280958.1 |
| Coordinates | 212337..212711 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PID00_RS00925 (209452) | 209452..209647 | + | 196 | Protein_182 | DUF905 family protein | - |
| PID00_RS00930 (209765) | 209765..210583 | + | 819 | WP_001234651.1 | DUF932 domain-containing protein | - |
| PID00_RS00935 (210925) | 210925..211398 | + | 474 | WP_005011597.1 | antirestriction protein | - |
| PID00_RS00940 (211414) | 211414..211890 | + | 477 | WP_005011624.1 | RadC family protein | - |
| PID00_RS00945 (211953) | 211953..212174 | + | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| PID00_RS00950 (212337) | 212337..212711 | + | 375 | WP_001280958.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PID00_RS00955 (212758) | 212758..213132 | + | 375 | WP_000854917.1 | TA system toxin CbtA family protein | Toxin |
| PID00_RS00960 (213129) | 213129..213620 | + | 492 | WP_000976828.1 | DUF5983 family protein | - |
| PID00_RS00965 (213632) | 213632..213829 | + | 198 | WP_000839282.1 | DUF957 domain-containing protein | - |
| PID00_RS00970 (213914) | 213914..214474 | + | 561 | Protein_191 | DUF4942 domain-containing protein | - |
| PID00_RS00975 (214546) | 214546..215550 | + | 1005 | WP_001179707.1 | IS110-like element ISSfl8 family transposase | - |
| PID00_RS00980 (215832) | 215832..216113 | + | 282 | Protein_193 | DUF4942 domain-containing protein | - |
| PID00_RS00990 (216584) | 216584..217522 | + | 939 | WP_000351317.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 214546..215550 | 1004 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14145.22 Da Isoelectric Point: 7.7761
>T267746 WP_000854917.1 NZ_CP116067:212758-213132 [Escherichia coli]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13793.62 Da Isoelectric Point: 6.4651
>AT267746 WP_001280958.1 NZ_CP116067:212337-212711 [Escherichia coli]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q93EZ7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4PAV2 |