Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4194536..4195154 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PIH14_RS20315 | Protein ID | WP_001291435.1 |
Coordinates | 4194536..4194754 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PIH14_RS20320 | Protein ID | WP_000344800.1 |
Coordinates | 4194780..4195154 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS20280 (4189825) | 4189825..4190397 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
PIH14_RS20285 (4190428) | 4190428..4190739 | - | 312 | WP_000409911.1 | MGMT family protein | - |
PIH14_RS20295 (4191118) | 4191118..4191471 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PIH14_RS20300 (4191513) | 4191513..4193063 | - | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PIH14_RS20305 (4193227) | 4193227..4193697 | - | 471 | WP_000136192.1 | YlaC family protein | - |
PIH14_RS20310 (4193813) | 4193813..4194364 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PIH14_RS20315 (4194536) | 4194536..4194754 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PIH14_RS20320 (4194780) | 4194780..4195154 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PIH14_RS20325 (4195700) | 4195700..4198849 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PIH14_RS20330 (4198872) | 4198872..4200065 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T267742 WP_001291435.1 NZ_CP116046:c4194754-4194536 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT267742 WP_000344800.1 NZ_CP116046:c4195154-4194780 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |