Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2187064..2187905 | Replicon | chromosome |
Accession | NZ_CP116046 | ||
Organism | Escherichia coli strain EC812A1 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | PIH14_RS10685 | Protein ID | WP_000854822.1 |
Coordinates | 2187064..2187447 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | PIH14_RS10690 | Protein ID | WP_053271974.1 |
Coordinates | 2187537..2187905 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIH14_RS10655 (2182709) | 2182709..2184550 | + | 1842 | WP_000437375.1 | RNA polymerase sigma factor RpoD | - |
PIH14_RS10660 (2184629) | 2184629..2185135 | - | 507 | WP_000228937.1 | G/U mismatch-specific DNA glycosylase | - |
PIH14_RS10670 (2185434) | 2185434..2186279 | - | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
PIH14_RS10675 (2186376) | 2186376..2186573 | - | 198 | WP_000839263.1 | DUF957 domain-containing protein | - |
PIH14_RS10680 (2186585) | 2186585..2187073 | - | 489 | WP_001177592.1 | DUF5983 family protein | - |
PIH14_RS10685 (2187064) | 2187064..2187447 | - | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
PIH14_RS10690 (2187537) | 2187537..2187905 | - | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
PIH14_RS10695 (2187985) | 2187985..2188206 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
PIH14_RS10700 (2188275) | 2188275..2188751 | - | 477 | WP_001186747.1 | RadC family protein | - |
PIH14_RS10705 (2188766) | 2188766..2189251 | - | 486 | WP_112915495.1 | antirestriction protein | - |
PIH14_RS10710 (2189342) | 2189342..2190160 | - | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T267735 WP_000854822.1 NZ_CP116046:c2187447-2187064 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT267735 WP_053271974.1 NZ_CP116046:c2187905-2187537 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |